PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0408400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 578aa    MW: 62456.8 Da    PI: 4.4252
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0408400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.7e-132162346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +WT eE +ll++a + +Gg+ W+ Ia+++  ++t  qc +++++
  ORGLA03G0408400.1 21 SWTDEETLLLLEALEIFGGK-WTEIAEHVA-TKTKAQCMLHFLQ 62
                       7*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129321.471768IPR017884SANT domain
SuperFamilySSF466892.77E-131872IPR009057Homeodomain-like
SMARTSM007176.6E-131866IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-92061IPR009057Homeodomain-like
PfamPF002495.6E-122163IPR001005SANT/Myb domain
CDDcd001670.002443963No hitNo description
PfamPF164951.2E-20464541IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MAKTDFILMD SSEVSGASGT SWTDEETLLL LEALEIFGGK WTEIAEHVAT KTKAQCMLHF  60
LQMQIEDRFH GDEDINQNIQ ENTEQASAEK GAAEIPDKME VEEKAEGKDT AGEKTPEKAE  120
GNSVEAQTED GNAIENKDAN NSGGTDSVKS LNTDEPKKSS DADPPKSSSD AEPVVKENSV  180
DVDTSRENAS NFAIDTLKSA FEAVGYFPEH EGSFADAGNP VMALASFLAG LVEDDTATNS  240
CRSSLKAISE VSPALQLATR HCFILEDPPS DVKDMSGNAS TTSTDGDKRK DKDKTQDSID  300
SEVEGINKKG ETVLSVEGKK SYPISPKGQD TDKKDECDED PSVDPKHNNG KESDDPVSLD  360
KSVSNNKKGN TMETSNPEMI EDKASSEVNP ADDSSLEGKV EMKKTKDAVA NATTAQEQKQ  420
SQILENGKME EPKSTEDVAA DEENSSRVTA NLTDSITRLK RAAATAISAA AVKAKLLADH  480
EEEQIRQLAA LMIDKLYRKV EAKVSFLTEV EHLVQRTREY TEKTRKKLLM ERNAIIAARM  540
GSLPSRPNQP GAAGNRLPAG YGGPIVRPPP NAMPRPSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0589890.0AK058989.1 Oryza sativa Japonica Group cDNA clone:001-020-F03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632283.10.0PREDICTED: SWI/SNF complex subunit SWI3D isoform X2
TrEMBLI1PI880.0I1PI88_ORYGL; Uncharacterized protein
STRINGORGLA03G0408400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45421214